(data stored in ACNUC30630 zone)

EMBL: CP001977.PE228

CP001977.PE228       Location/Qualifiers
FT   CDS             complement(259571..260533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3232"
FT                   /product="phosphotransferase enzyme family"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00148"
FT                   /db_xref="GOA:D4H946"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4H946"
FT                   /protein_id="ADE00148.1"
FT                   /translation="MKPSRVRWDQLPDSVHHRVAEILGSPVSVDHVQTHGTTPGVASRV
FT                   VTADGSHAFVKIGHPAINEAIPSLNRREATLLSLLPDTAPAPRLLGRIDVDGWVGMVTS
FT                   DIEGPHPDLPWSDEDIDTTLASLSRLTEVTADFHQQWEPFSARLQNTPSVWEQFMADTP
FT                   TDLDPWLIERLPDLAGRVERLARHAYGDTVIHNAVRSDNVLLRTSGTVLVDWSHAVIGP
FT                   AWVDAAGLIVDIIHTDPIDAPRWNRADDLVKRVAAEFSPSTHGGPAVEPIVDFLVAILG
FT                   LSERECRNPDPAGMPQFREFQRERASRLRAWLWASEHLA"
     MKPSRVRWDQ LPDSVHHRVA EILGSPVSVD HVQTHGTTPG VASRVVTADG SHAFVKIGHP        60
     AINEAIPSLN RREATLLSLL PDTAPAPRLL GRIDVDGWVG MVTSDIEGPH PDLPWSDEDI       120
     DTTLASLSRL TEVTADFHQQ WEPFSARLQN TPSVWEQFMA DTPTDLDPWL IERLPDLAGR       180
     VERLARHAYG DTVIHNAVRS DNVLLRTSGT VLVDWSHAVI GPAWVDAAGL IVDIIHTDPI       240
     DAPRWNRADD LVKRVAAEFS PSTHGGPAVE PIVDFLVAIL GLSERECRNP DPAGMPQFRE       300
     FQRERASRLR AWLWASEHLA                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page