(data stored in ACNUC30630 zone)

EMBL: CP001977.PE23

CP001977.PE23        Location/Qualifiers
FT   CDS             complement(25000..25302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3023"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00779"
FT                   /db_xref="GOA:D4HEI1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI1"
FT                   /protein_id="ADE00779.1"
FT                   /translation="MESEVKVLVACGSGIATSTVAQEKVKEILRDAKIPAKITKGTVGQ
FT                   LPVLQDGVDVIMLTTRYGKPLNKPIIQVFGLISGINEDAVAEEIISTCRDVLNQS"
     MESEVKVLVA CGSGIATSTV AQEKVKEILR DAKIPAKITK GTVGQLPVLQ DGVDVIMLTT        60
     RYGKPLNKPI IQVFGLISGI NEDAVAEEII STCRDVLNQS                             100
//

If you have problems or comments...

PBIL Back to PBIL home page