(data stored in ACNUC30630 zone)

EMBL: CP001977.PE234

CP001977.PE234       Location/Qualifiers
FT   CDS             267262..268107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00117"
FT                   /db_xref="UniProtKB/TrEMBL:D4H952"
FT                   /protein_id="ADE00117.1"
FT                   /translation="MAGRNNDLRTLYSHWTGQIRKSRLGVLLVPDADYDGDLLDVRLPR
FT                   HPAATVNKGTLKYSLTYRTIKQPLSGDVLEVVTSARSCPDATWDGTAKVVPHSPALTSI
FT                   DAKCGWTITLKTLPQEEPVTVTAKFPATEAAISNQANLQTWLQNQQQATDKALNNDAVT
FT                   STAYSLQRLQTMRIKIPPRVKEGSAIPVTILGTWPGGENEMTPIYTTPFSSNPTSILTD
FT                   ITGGKLENVRLTDRCSGAVSITPDGHDVSALHPASCSIGAEIGNYQVQESPITIVAGGS
FT                   "
     MAGRNNDLRT LYSHWTGQIR KSRLGVLLVP DADYDGDLLD VRLPRHPAAT VNKGTLKYSL        60
     TYRTIKQPLS GDVLEVVTSA RSCPDATWDG TAKVVPHSPA LTSIDAKCGW TITLKTLPQE       120
     EPVTVTAKFP ATEAAISNQA NLQTWLQNQQ QATDKALNND AVTSTAYSLQ RLQTMRIKIP       180
     PRVKEGSAIP VTILGTWPGG ENEMTPIYTT PFSSNPTSIL TDITGGKLEN VRLTDRCSGA       240
     VSITPDGHDV SALHPASCSI GAEIGNYQVQ ESPITIVAGG S                           281
//

If you have problems or comments...

PBIL Back to PBIL home page