(data stored in ACNUC30630 zone)

EMBL: CP001977.PE238

CP001977.PE238       Location/Qualifiers
FT   CDS             complement(274189..276981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3242"
FT                   /product="YD repeat protein (3 repeats)"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00247"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J0"
FT                   /protein_id="ADE00247.1"
FT                   /translation="MVDFSVFGDYQNPVEFNFSTAEGFSSQLRWTSQRINIFDARTSLV
FT                   ESIASRGFRGFFATVFTQNIHICSADAMALSEALTTAADMVDYLAEQARLENKRRQQVR
FT                   DFAAQHDDFGDHVRDFFTGVDVPPNLTPAEPPSPQLLHPPVTGDRQQDRSIRGSSGGIS
FT                   AADPKDLISAAQVLGEAAAQVPSGSVLAGWFDDFTSQCKYGTVEVGDLFVQLDRWRGLN
FT                   DGDVEWLHAVAKAFQAAGSGVITLPNSALRAALRAAGTPLWRTDLDITSPGLSGIDPRT
FT                   GYLEDPINSATGNFIEPETDLAFAAASSPLALSRMYNSIQAVRGQGGVFGPGWVSILDQ
FT                   CLLVKPGCVEWVREDGRHIAFAVEAAPTAVLPTTNQLPNPAEEDEKPVEQWRAQGENLW
FT                   LSRVSASQLPEFLRDPATSKWVWVISDNRGGRWVFTEGGAWVCSGSSQRDVVHTVREGD
FT                   RVTAMETSWGHKITVSYGGARVVSAISSDGRCVRYSYDDENRLVQVDGPDGSRRYEWDD
FT                   TLITTVVDACGNAECINSYDGRGRITSQQAANGRTVHFRYLPGGVTAASDADGTNANTW
FT                   ICDAHGRTTGVVDAHGGQVSMTYDSFGNMVRCVDRAGNVTSHRYDQRGRLTHTDLPTGG
FT                   TIDCSWDDLDRLVSTTLANGAQTTFEYDGTERDPVRVTDPCGGVTVAEWKDGLLLRATN
FT                   PVGVSLRFSYDHHAELVRVEDAHGEASRLIRDEAGRIVETISPGGATTRFSYDDAGRLA
FT                   AVVTPDGATWEHRYDVAGHLIELVAPDSGVTKWEYHPDGQISRVIDPLGRVIEHSYDHL
FT                   GNLAGMQLPDGSAWSFIHDALSRLTQVVAPDEARWTYAYDVDGNLSGVTDPAGFARPGS
FT                   LLTVSLPAPPRIVTGTNSTASMPIPTVLLLPSPMSLAPSRSSRVICVADRLSFRTSLAR
FT                   "
     MVDFSVFGDY QNPVEFNFST AEGFSSQLRW TSQRINIFDA RTSLVESIAS RGFRGFFATV        60
     FTQNIHICSA DAMALSEALT TAADMVDYLA EQARLENKRR QQVRDFAAQH DDFGDHVRDF       120
     FTGVDVPPNL TPAEPPSPQL LHPPVTGDRQ QDRSIRGSSG GISAADPKDL ISAAQVLGEA       180
     AAQVPSGSVL AGWFDDFTSQ CKYGTVEVGD LFVQLDRWRG LNDGDVEWLH AVAKAFQAAG       240
     SGVITLPNSA LRAALRAAGT PLWRTDLDIT SPGLSGIDPR TGYLEDPINS ATGNFIEPET       300
     DLAFAAASSP LALSRMYNSI QAVRGQGGVF GPGWVSILDQ CLLVKPGCVE WVREDGRHIA       360
     FAVEAAPTAV LPTTNQLPNP AEEDEKPVEQ WRAQGENLWL SRVSASQLPE FLRDPATSKW       420
     VWVISDNRGG RWVFTEGGAW VCSGSSQRDV VHTVREGDRV TAMETSWGHK ITVSYGGARV       480
     VSAISSDGRC VRYSYDDENR LVQVDGPDGS RRYEWDDTLI TTVVDACGNA ECINSYDGRG       540
     RITSQQAANG RTVHFRYLPG GVTAASDADG TNANTWICDA HGRTTGVVDA HGGQVSMTYD       600
     SFGNMVRCVD RAGNVTSHRY DQRGRLTHTD LPTGGTIDCS WDDLDRLVST TLANGAQTTF       660
     EYDGTERDPV RVTDPCGGVT VAEWKDGLLL RATNPVGVSL RFSYDHHAEL VRVEDAHGEA       720
     SRLIRDEAGR IVETISPGGA TTRFSYDDAG RLAAVVTPDG ATWEHRYDVA GHLIELVAPD       780
     SGVTKWEYHP DGQISRVIDP LGRVIEHSYD HLGNLAGMQL PDGSAWSFIH DALSRLTQVV       840
     APDEARWTYA YDVDGNLSGV TDPAGFARPG SLLTVSLPAP PRIVTGTNST ASMPIPTVLL       900
     LPSPMSLAPS RSSRVICVAD RLSFRTSLAR                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page