(data stored in ACNUC30630 zone)

EMBL: CP001977.PE239

CP001977.PE239       Location/Qualifiers
FT   CDS             complement(277101..277823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99560"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J1"
FT                   /protein_id="ADD99560.1"
FT                   /translation="MTKKLTKTCLLGMVGIMAISLAACGDKTNSSSDTPANPSPSTKAV
FT                   KRISKDDFTKAFSHKKIDGHTFVIQDNSQLRPVVDNLDKTLSQAKISPAGCDAALRQSS
FT                   LGLTSHEISDTLVAVSDKPSTRIIVTTAMSDRQKKAYKSQEEQTSKCGHTTLSTQGVNH
FT                   GLEINIKASPIKGYENISKQAALFDVSIKRSTGTSDHGYQAYIWLNNDQAIRIFGRDAG
FT                   IVKSTLQSATKALGIAKK"
     MTKKLTKTCL LGMVGIMAIS LAACGDKTNS SSDTPANPSP STKAVKRISK DDFTKAFSHK        60
     KIDGHTFVIQ DNSQLRPVVD NLDKTLSQAK ISPAGCDAAL RQSSLGLTSH EISDTLVAVS       120
     DKPSTRIIVT TAMSDRQKKA YKSQEEQTSK CGHTTLSTQG VNHGLEINIK ASPIKGYENI       180
     SKQAALFDVS IKRSTGTSDH GYQAYIWLNN DQAIRIFGRD AGIVKSTLQS ATKALGIAKK       240
//

If you have problems or comments...

PBIL Back to PBIL home page