(data stored in ACNUC30630 zone)

EMBL: CP001977.PE24

CP001977.PE24        Location/Qualifiers
FT   CDS             complement(25292..25675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00114"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI2"
FT                   /protein_id="ADE00114.1"
FT                   /translation="MAEMMNAALMYGPGDIRVEQMPKPTCPPGGFVLRVDAVGLCGSDI
FT                   RNLTTDSRKGDYPFIYGHFGATSVQVQKAFELIIDDKFPAEQVISKVLPLSRINDAIEL
FT                   TRTGEAMKVVLVPDRKESEHHGK"
     MAEMMNAALM YGPGDIRVEQ MPKPTCPPGG FVLRVDAVGL CGSDIRNLTT DSRKGDYPFI        60
     YGHFGATSVQ VQKAFELIID DKFPAEQVIS KVLPLSRIND AIELTRTGEA MKVVLVPDRK       120
     ESEHHGK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page