(data stored in ACNUC30630 zone)

EMBL: CP001977.PE243

CP001977.PE243       Location/Qualifiers
FT   CDS             282248..282571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3249"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99493"
FT                   /db_xref="GOA:D4H9J5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J5"
FT                   /protein_id="ADD99493.1"
FT                   /translation="MTTGGFDLGGLDIGALLAQAQSVQNQLEAAQNQLAESNFEGTAGG
FT                   GLVRATVTGTGELDALTIAPEALEDTDAETLADLVVAAVKDATGQARAMQQSLMPQMPS
FT                   LGL"
     MTTGGFDLGG LDIGALLAQA QSVQNQLEAA QNQLAESNFE GTAGGGLVRA TVTGTGELDA        60
     LTIAPEALED TDAETLADLV VAAVKDATGQ ARAMQQSLMP QMPSLGL                     107
//

If you have problems or comments...

PBIL Back to PBIL home page