(data stored in ACNUC30630 zone)

EMBL: CP001977.PE246

CP001977.PE246       Location/Qualifiers
FT   CDS             283896..284678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3252"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01105"
FT                   /db_xref="GOA:D4H9J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J8"
FT                   /protein_id="ADE01105.1"
FT                   /translation="MTSTPLHAADQITPTMQRTVLSLDHVSRSFGEGEQRVDAIVDVSL
FT                   GVNPGTFAAVMGPSGSGKSTLLGLAGGLDQPTSGTVSVCGEPLGGMSRDDLARVRRRQL
FT                   GFVFQDYNLVPTLTAVENVSVPLELDGVSATRARKAAEIALERVGVPELVDRHIEKMSG
FT                   GQRQRVAIARGIVGDRRVLLADEPTGALDSVTGDEIMALIRTLADEGVAVVLVTHEARH
FT                   AAWADRVIFLRDGRLVDESQVVSDPMELLNDNPKRGRW"
     MTSTPLHAAD QITPTMQRTV LSLDHVSRSF GEGEQRVDAI VDVSLGVNPG TFAAVMGPSG        60
     SGKSTLLGLA GGLDQPTSGT VSVCGEPLGG MSRDDLARVR RRQLGFVFQD YNLVPTLTAV       120
     ENVSVPLELD GVSATRARKA AEIALERVGV PELVDRHIEK MSGGQRQRVA IARGIVGDRR       180
     VLLADEPTGA LDSVTGDEIM ALIRTLADEG VAVVLVTHEA RHAAWADRVI FLRDGRLVDE       240
     SQVVSDPMEL LNDNPKRGRW                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page