(data stored in ACNUC30630 zone)

EMBL: CP001977.PE248

CP001977.PE248       Location/Qualifiers
FT   CDS             complement(287321..289156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3254"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99142"
FT                   /db_xref="GOA:D4H9K0"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K0"
FT                   /protein_id="ADD99142.1"
FT                   /translation="MAEKRPGARSGSASRNHPRSWHGDDPIPRTADGIDARIFRPGQAS
FT                   AQPATPPQSSATPPEPPVNEENPTRMAPVGNLSRSWPLTRSRTVSPHNGQAKLRHSRPP
FT                   RAHRTRRVPLEKLFRAKTPVEPTLALNLGDAEMAIMQARRVVDLVTRVAVMAISVGGSA
FT                   SEAVAIALRITATYGVTVHIDITNTSVIVTQHRGLDEDPITVLRVVRSRSNDYQRLGEL
FT                   QLLVDDICDKTVGLEEAADRLAAITRSPRLYRQWFVTMNIGLMGAGLSTLFGGTVMDGV
FT                   LSFFSTCIVDATVQAMARKRITNFFAQAAGGAIATAFALIVMVYMAASNHPLPLSPSLI
FT                   VAAGIVSLLAGGSFVAASQDALDGYVVTSSGRFLEGFVQTGGVILGVITAMWIGLRLGV
FT                   PGYISPALGFSTNPVLQMVAAAVIAVTFGISSHAGYRTLAICAALGAAAWAGYLLGMQL
FT                   TGSVSAASGLAAMVAGFIAGLGAKRWKVPQLGLVTIAIVPLMPGVMMYRALYMIVNAQN
FT                   ETGGTSNAGWTLFLEALLVGVALAVGGSFGALLARPFTLPKDLRSRLATLASWGAGQAV
FT                   PRERRRRRSQPPADPHHPALNNTETDPTVTGTWAR"
     MAEKRPGARS GSASRNHPRS WHGDDPIPRT ADGIDARIFR PGQASAQPAT PPQSSATPPE        60
     PPVNEENPTR MAPVGNLSRS WPLTRSRTVS PHNGQAKLRH SRPPRAHRTR RVPLEKLFRA       120
     KTPVEPTLAL NLGDAEMAIM QARRVVDLVT RVAVMAISVG GSASEAVAIA LRITATYGVT       180
     VHIDITNTSV IVTQHRGLDE DPITVLRVVR SRSNDYQRLG ELQLLVDDIC DKTVGLEEAA       240
     DRLAAITRSP RLYRQWFVTM NIGLMGAGLS TLFGGTVMDG VLSFFSTCIV DATVQAMARK       300
     RITNFFAQAA GGAIATAFAL IVMVYMAASN HPLPLSPSLI VAAGIVSLLA GGSFVAASQD       360
     ALDGYVVTSS GRFLEGFVQT GGVILGVITA MWIGLRLGVP GYISPALGFS TNPVLQMVAA       420
     AVIAVTFGIS SHAGYRTLAI CAALGAAAWA GYLLGMQLTG SVSAASGLAA MVAGFIAGLG       480
     AKRWKVPQLG LVTIAIVPLM PGVMMYRALY MIVNAQNETG GTSNAGWTLF LEALLVGVAL       540
     AVGGSFGALL ARPFTLPKDL RSRLATLASW GAGQAVPRER RRRRSQPPAD PHHPALNNTE       600
     TDPTVTGTWA R                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page