(data stored in ACNUC30630 zone)

EMBL: CP001977.PE270

CP001977.PE270       Location/Qualifiers
FT   CDS             308930..309766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3275"
FT                   /product="CpaE-like protein"
FT                   /note="identified by match to protein family HMM TIGR03815"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00130"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M2"
FT                   /protein_id="ADE00130.1"
FT                   /translation="MAGSVMAWGLSPRSGTYVVGFDAEEAARWSAGLSASVIVVPRANQ
FT                   VLTEILHDELATTSRATVVQVNSSGGGTGVSTLASGLAWAAARSGIKVGLVELNPSAGG
FT                   IDLLLGIERKDGWRWPELASARGVTTDLGSHVPSLDGVEVVSAGRVGVHVPPAARRAVV
FT                   DSLAGDHDLVVVDPGGLDTPEVTVNVKVGVVAADLRSVMTARGQNLPDLLVARRGPGRS
FT                   MPDEDIESVLGVRPDMTIKDDRRLARGQGDGEAPWVVASRRWRSGCAELVDQVMGS"
     MAGSVMAWGL SPRSGTYVVG FDAEEAARWS AGLSASVIVV PRANQVLTEI LHDELATTSR        60
     ATVVQVNSSG GGTGVSTLAS GLAWAAARSG IKVGLVELNP SAGGIDLLLG IERKDGWRWP       120
     ELASARGVTT DLGSHVPSLD GVEVVSAGRV GVHVPPAARR AVVDSLAGDH DLVVVDPGGL       180
     DTPEVTVNVK VGVVAADLRS VMTARGQNLP DLLVARRGPG RSMPDEDIES VLGVRPDMTI       240
     KDDRRLARGQ GDGEAPWVVA SRRWRSGCAE LVDQVMGS                               278
//

If you have problems or comments...

PBIL Back to PBIL home page