(data stored in ACNUC30630 zone)

EMBL: CP001977.PE271

CP001977.PE271       Location/Qualifiers
FT   CDS             309763..310929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3277"
FT                   /product="helicase/secretion neighborhood ATPase"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR03819"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99956"
FT                   /db_xref="GOA:D4H9M3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M3"
FT                   /protein_id="ADD99956.1"
FT                   /translation="MSGEEPDLKLVEQVRRRLAGLARDWTPMDVAHAILDCGRVASDKT
FT                   VLAVVEELRRTSTGAGRLDPLLAMDGVTDVLVNGPNQVFIDRGQGLELTDVTFSGPEEV
FT                   RALAVRLAAAVGRRLDDGNPWVDARLPDGIRVHAVLDVLARPGTCLSLRVPSRRCLSLD
FT                   DWVTGGSMALGCRRMIDTILSRKLAFLVTGGTGTGKTTLLSAMLTSLPSDQRLVIVEDS
FT                   REIWIDHPHWVSMEARAANSEGKGSVTLTDLVRQCLRMRPDRIVLGEVRGAELRDLLMA
FT                   LNTGHEGGCGTVHANGVAEVPARLEALAALGGLSREAASAQITAALHTVIHVERGERGR
FT                   RVAEIGVFVDVEGRAVVLPAVRWDADGVMTLGDGAGRLSQLLGMEVAR"
     MSGEEPDLKL VEQVRRRLAG LARDWTPMDV AHAILDCGRV ASDKTVLAVV EELRRTSTGA        60
     GRLDPLLAMD GVTDVLVNGP NQVFIDRGQG LELTDVTFSG PEEVRALAVR LAAAVGRRLD       120
     DGNPWVDARL PDGIRVHAVL DVLARPGTCL SLRVPSRRCL SLDDWVTGGS MALGCRRMID       180
     TILSRKLAFL VTGGTGTGKT TLLSAMLTSL PSDQRLVIVE DSREIWIDHP HWVSMEARAA       240
     NSEGKGSVTL TDLVRQCLRM RPDRIVLGEV RGAELRDLLM ALNTGHEGGC GTVHANGVAE       300
     VPARLEALAA LGGLSREAAS AQITAALHTV IHVERGERGR RVAEIGVFVD VEGRAVVLPA       360
     VRWDADGVMT LGDGAGRLSQ LLGMEVAR                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page