(data stored in ACNUC30630 zone)

EMBL: CP001977.PE279

CP001977.PE279       Location/Qualifiers
FT   CDS             316450..317967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3284"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99381"
FT                   /db_xref="GOA:D4H9N1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N1"
FT                   /protein_id="ADD99381.1"
FT                   /translation="MERSRAKIATMGRHLTVDEIEQLRHIFTDIGYVTDPVMAAIGDSG
FT                   QLGLTRNSTTPALRALAGRTDALAGAIRLWLLQQPVPVEQLAPLPLQALTEAGIVSTAG
FT                   STARALVDVRPYGSPDDGASGWTVSDLTPGLDKAITKIRPDYVLGVSPASVSLTQMAVP
FT                   THVGSALDMGCGCGVQSLHLSRHADHVVATDVNPRALEMAQLTCRLSHADVDIRDGSLY
FT                   DPCGHDTFDLIVTNPPYVMAPPSRDGQRLIYREGGFCGDGLVEAVVRGAPARLNDGGML
FT                   QVLANWAHIGDQPWSERLATWVEETGCDLWVVEREHLDVCEYIETWLTDAGLDGSAQWR
FT                   SRYDEWLSYFDNLDVTGVSLGWITLTKAGRDDPDLCFEEWPWQVAQPIGGTMARRAQAV
FT                   IWAHLSDEDLLARRWRIAPNVDSETTGRPGATDPEHVVLRQRRGLCRAVEMTTASGGVL
FT                   GACDGELTLAQITDAVSAILEVDHDALLIEVLPLVRECLRYGILETA"
     MERSRAKIAT MGRHLTVDEI EQLRHIFTDI GYVTDPVMAA IGDSGQLGLT RNSTTPALRA        60
     LAGRTDALAG AIRLWLLQQP VPVEQLAPLP LQALTEAGIV STAGSTARAL VDVRPYGSPD       120
     DGASGWTVSD LTPGLDKAIT KIRPDYVLGV SPASVSLTQM AVPTHVGSAL DMGCGCGVQS       180
     LHLSRHADHV VATDVNPRAL EMAQLTCRLS HADVDIRDGS LYDPCGHDTF DLIVTNPPYV       240
     MAPPSRDGQR LIYREGGFCG DGLVEAVVRG APARLNDGGM LQVLANWAHI GDQPWSERLA       300
     TWVEETGCDL WVVEREHLDV CEYIETWLTD AGLDGSAQWR SRYDEWLSYF DNLDVTGVSL       360
     GWITLTKAGR DDPDLCFEEW PWQVAQPIGG TMARRAQAVI WAHLSDEDLL ARRWRIAPNV       420
     DSETTGRPGA TDPEHVVLRQ RRGLCRAVEM TTASGGVLGA CDGELTLAQI TDAVSAILEV       480
     DHDALLIEVL PLVRECLRYG ILETA                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page