(data stored in ACNUC30630 zone)

EMBL: CP001977.PE287

CP001977.PE287       Location/Qualifiers
FT   CDS             326432..328114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3293"
FT                   /product="TAP-like protein"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF08386"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00087"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N9"
FT                   /protein_id="ADE00087.1"
FT                   /translation="MTPRVSRRRMFVSALMASSLFAVTACTSAGSRPPQSASVSRQSAS
FT                   HKPSASPSVTASVVPAQDKVDTNPPVASFDPKAHALMEGPQSPDRQAMHPARDNKPFSK
FT                   APAGKGTNRYLSRKISWHDCGTFQCADIPVPLDWDNPDGPAITLALKRKPAEGAAKATL
FT                   FINPGGPGGSGQDMVSSFQSSAFPDHDVIGWDPRGTGASTHVNCGPAKTMDGLFSLDAS
FT                   PDDEAEWNELIRGTRDFARSCRAYSGQLLDHVSTIDTARDLDYLRYLVGNKKLDYLGVS
FT                   YGTFLGATYAELYPGRVGHMVLDSTVNITNHDTVSQAVGFDRAFGDFAQWCANRGNRCA
FT                   LGTSEAEVRKATLNFLDRLDAHPMKVAGRELTQSLAATGIALFLYSGKQAYSYLIAALV
FT                   GAMKDGNGGYLLTASDYLNGRGKDGQWETIASAFPAISCLDQADFGLKHARQEWPQEVA
FT                   KAPTLGKALGVAPICEVWTARPAPQLYLTARGAAPILVLGATGDPATPYEQATWMAGQL
FT                   KSGVLLTWRGSGHSAWELGNQCVKKAVEGYVNDGKMPKDNTVC"
     MTPRVSRRRM FVSALMASSL FAVTACTSAG SRPPQSASVS RQSASHKPSA SPSVTASVVP        60
     AQDKVDTNPP VASFDPKAHA LMEGPQSPDR QAMHPARDNK PFSKAPAGKG TNRYLSRKIS       120
     WHDCGTFQCA DIPVPLDWDN PDGPAITLAL KRKPAEGAAK ATLFINPGGP GGSGQDMVSS       180
     FQSSAFPDHD VIGWDPRGTG ASTHVNCGPA KTMDGLFSLD ASPDDEAEWN ELIRGTRDFA       240
     RSCRAYSGQL LDHVSTIDTA RDLDYLRYLV GNKKLDYLGV SYGTFLGATY AELYPGRVGH       300
     MVLDSTVNIT NHDTVSQAVG FDRAFGDFAQ WCANRGNRCA LGTSEAEVRK ATLNFLDRLD       360
     AHPMKVAGRE LTQSLAATGI ALFLYSGKQA YSYLIAALVG AMKDGNGGYL LTASDYLNGR       420
     GKDGQWETIA SAFPAISCLD QADFGLKHAR QEWPQEVAKA PTLGKALGVA PICEVWTARP       480
     APQLYLTARG AAPILVLGAT GDPATPYEQA TWMAGQLKSG VLLTWRGSGH SAWELGNQCV       540
     KKAVEGYVND GKMPKDNTVC                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page