(data stored in ACNUC30630 zone)

EMBL: CP001977.PE292

CP001977.PE292       Location/Qualifiers
FT   CDS             332485..333336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99242"
FT                   /db_xref="GOA:D4H9P4"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P4"
FT                   /protein_id="ADD99242.1"
FT                   /translation="MQTPSEPVEWQDSMPTQQWQVQDSTPTQQWTTNSQSGPQQPSQGQ
FT                   YRDLGASQMPDDWFRDPEAERTRVMAAVPENPVFTPPPPPSTPAMAYPPPPSGDSSRHR
FT                   KVLIGLVVGLLVLVVLGAVLLFAGGLKGRSGSEPAVVATPSASSQPKQSASEDPQATSI
FT                   DTTPSFLMSSPASPSPVPSSPALSTPTPLSPQSPTLSARQVADKLPDGDTLCSSSVGAV
FT                   GTTSCPFALEVANAIPAGAQGDYEVQAYSPVTGKTYTMKCETQESYTTCTGGIAAKVHI
FT                   LR"
     MQTPSEPVEW QDSMPTQQWQ VQDSTPTQQW TTNSQSGPQQ PSQGQYRDLG ASQMPDDWFR        60
     DPEAERTRVM AAVPENPVFT PPPPPSTPAM AYPPPPSGDS SRHRKVLIGL VVGLLVLVVL       120
     GAVLLFAGGL KGRSGSEPAV VATPSASSQP KQSASEDPQA TSIDTTPSFL MSSPASPSPV       180
     PSSPALSTPT PLSPQSPTLS ARQVADKLPD GDTLCSSSVG AVGTTSCPFA LEVANAIPAG       240
     AQGDYEVQAY SPVTGKTYTM KCETQESYTT CTGGIAAKVH ILR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page