(data stored in ACNUC30630 zone)

EMBL: CP001977.PE293

CP001977.PE293       Location/Qualifiers
FT   CDS             complement(333354..333839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3300"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00512"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P5"
FT                   /protein_id="ADE00512.1"
FT                   /translation="MHTLFLMRHAQPASHAPGEDRERPLTDVGRRQAREVGTRLGLRNV
FT                   GHALVSDALRTRQTWDCLQLDCPVEFMRALYYCGTDTVRQRIGEIDDDVDNLLIIAHAP
FT                   TIPGLAAQLAAMSGAENEVGCWYPPATLTEVEVDGTWADLKDEYFDKVRLVGVQRPM"
     MHTLFLMRHA QPASHAPGED RERPLTDVGR RQAREVGTRL GLRNVGHALV SDALRTRQTW        60
     DCLQLDCPVE FMRALYYCGT DTVRQRIGEI DDDVDNLLII AHAPTIPGLA AQLAAMSGAE       120
     NEVGCWYPPA TLTEVEVDGT WADLKDEYFD KVRLVGVQRP M                           161
//

If you have problems or comments...

PBIL Back to PBIL home page