(data stored in ACNUC30630 zone)

EMBL: CP001977.PE305

CP001977.PE305       Location/Qualifiers
FT   CDS             344236..344874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99922"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA39"
FT                   /protein_id="ADD99922.1"
FT                   /translation="MKGRPVFVGCVAVLVLTACGGAGVSAGSHPHTAVASSSVSVVGMS
FT                   APPSASVSVMGSEQAAAVESAAGKAIRDKVKEDGGPIPKEVANVSFHPNLDDNVDVTAH
FT                   VVSIKAGPTGTVLTFWLTSNTIDHAMGPVFPEDFPSLVDTVGGVKYGVNYFSKAGDTSK
FT                   FVVGSEEPEIDAKSVYVMQASYPPLPKSVTKVKIAIGSAKTSPDIPVTR"
     MKGRPVFVGC VAVLVLTACG GAGVSAGSHP HTAVASSSVS VVGMSAPPSA SVSVMGSEQA        60
     AAVESAAGKA IRDKVKEDGG PIPKEVANVS FHPNLDDNVD VTAHVVSIKA GPTGTVLTFW       120
     LTSNTIDHAM GPVFPEDFPS LVDTVGGVKY GVNYFSKAGD TSKFVVGSEE PEIDAKSVYV       180
     MQASYPPLPK SVTKVKIAIG SAKTSPDIPV TR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page