(data stored in ACNUC30630 zone)

EMBL: CP001977.PE306

CP001977.PE306       Location/Qualifiers
FT   CDS             345123..345602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99271"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA40"
FT                   /protein_id="ADD99271.1"
FT                   /translation="MGGLMLGVGLVGCSDSEEGWESVTVDRITVSHPTEWVEKPPENEN
FT                   FTKNFTDGPHGMQIAGHYSDDTEPTLAWSVLEFMIRGTFQGYDPKGYQEITVKGAARAI
FT                   KCPFDFTYKGKSARGYWLVASGVLPTEGSAIVLLRLPRDDTNLVDKIIASMSFKA"
     MGGLMLGVGL VGCSDSEEGW ESVTVDRITV SHPTEWVEKP PENENFTKNF TDGPHGMQIA        60
     GHYSDDTEPT LAWSVLEFMI RGTFQGYDPK GYQEITVKGA ARAIKCPFDF TYKGKSARGY       120
     WLVASGVLPT EGSAIVLLRL PRDDTNLVDK IIASMSFKA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page