(data stored in ACNUC30630 zone)

EMBL: CP001977.PE320

CP001977.PE320       Location/Qualifiers
FT   CDS             complement(357564..358328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3327"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00552"
FT                   /db_xref="GOA:D4HAI7"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAI7"
FT                   /protein_id="ADE00552.1"
FT                   /translation="MWVLLAVAIVVIGFALRLNAMLVVAVAGIAAGLIAGMSPVKLIET
FT                   FGTGFASSRSVTVFIVVLPVIGLLERHGLMQQAGRLMSKMKSMTAGKLLAVYLAVRQIA
FT                   AAVGLSSIGGPAQAVRPLVVPMAEAAARRTHPRYTRKMREKLRSYASSADTIGLFFGED
FT                   VFIAIGSILLITGFVDATYNLKLEALQIALWAIPTAICAFLIHAPRLWLLDRKLAKMAA
FT                   EGGDNVDTDEVPEPGHTVSLPSGGNPEQGVHE"
     MWVLLAVAIV VIGFALRLNA MLVVAVAGIA AGLIAGMSPV KLIETFGTGF ASSRSVTVFI        60
     VVLPVIGLLE RHGLMQQAGR LMSKMKSMTA GKLLAVYLAV RQIAAAVGLS SIGGPAQAVR       120
     PLVVPMAEAA ARRTHPRYTR KMREKLRSYA SSADTIGLFF GEDVFIAIGS ILLITGFVDA       180
     TYNLKLEALQ IALWAIPTAI CAFLIHAPRL WLLDRKLAKM AAEGGDNVDT DEVPEPGHTV       240
     SLPSGGNPEQ GVHE                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page