(data stored in ACNUC30630 zone)

EMBL: CP001977.PE322

CP001977.PE322       Location/Qualifiers
FT   CDS             359218..359838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3329"
FT                   /product="conserved hypothetical protein TIGR00370"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF02682"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99217"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAI9"
FT                   /protein_id="ADD99217.1"
FT                   /translation="MRLLPAGRTAVLVELDDAGQRRRLHRTLSEHPAVGTVDLVPAQTT
FT                   VLIDVESPDQLPAAVAHVQEFIAAGLDCVEQGAREIVEVPVRYDGLDLSDVAELLSMTT
FT                   DELVKRHSDQQWTVEFAGFMPGFGYMSGADWPYRIPRRDSPRTRIPPGSIALADGFTGV
FT                   YPQASPGGWQIIGTTDAILWDEKADPPALLLPGAVIRFEVVDS"
     MRLLPAGRTA VLVELDDAGQ RRRLHRTLSE HPAVGTVDLV PAQTTVLIDV ESPDQLPAAV        60
     AHVQEFIAAG LDCVEQGARE IVEVPVRYDG LDLSDVAELL SMTTDELVKR HSDQQWTVEF       120
     AGFMPGFGYM SGADWPYRIP RRDSPRTRIP PGSIALADGF TGVYPQASPG GWQIIGTTDA       180
     ILWDEKADPP ALLLPGAVIR FEVVDS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page