(data stored in ACNUC30630 zone)

EMBL: CP001977.PE328

CP001977.PE328       Location/Qualifiers
FT   CDS             complement(364873..365529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3335"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04967; match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00883"
FT                   /db_xref="GOA:D4HAJ5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ5"
FT                   /protein_id="ADE00883.1"
FT                   /translation="MLPVRVLLVDDDTLVRRAVRQILEAADDLEVVGEASDGDGAVRQA
FT                   PQADVVLMDLRMPGMSGVEATSRITHSPSSPKVVVLTTVTADAAITDAVHAGASGFLLK
FT                   ASSPDDIVNAVRAVHAGDAFMSPTSTRQLLEQLRGDAGRRVRGAARKTLSALTDREREV
FT                   AIAVAEGLTNDAIAARLNVSASTVKAHLSTIQTKLDVDSRVRIAVLVERAGYLAA"
     MLPVRVLLVD DDTLVRRAVR QILEAADDLE VVGEASDGDG AVRQAPQADV VLMDLRMPGM        60
     SGVEATSRIT HSPSSPKVVV LTTVTADAAI TDAVHAGASG FLLKASSPDD IVNAVRAVHA       120
     GDAFMSPTST RQLLEQLRGD AGRRVRGAAR KTLSALTDRE REVAIAVAEG LTNDAIAARL       180
     NVSASTVKAH LSTIQTKLDV DSRVRIAVLV ERAGYLAA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page