(data stored in ACNUC30630 zone)

EMBL: CP001977.PE344

CP001977.PE344       Location/Qualifiers
FT   CDS             380934..382985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3351"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM PF06778"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99943"
FT                   /db_xref="GOA:D4HAL1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL1"
FT                   /protein_id="ADD99943.1"
FT                   /translation="MTANPYAAPTDPLAPYSAVLVVSFGGPRSPEEVMPFLRRVSHGRI
FT                   PEERLADVARHYDRFGGVSPINDATDVFVNAIGNELRRHGVRVPVLLGNRNGTPFLEEA
FT                   LTDMHAHGVRRVLAVVTSAYASYSGCRQYREEIATALAHAGITDMQVDKVPPFNEAPGF
FT                   IRANAEALMQAFMRIPPTPLEATRVVFVTHSIPDSMQDASGAGQPGTDYISQHKAVCER
FT                   VAGQVRQVFGNMPQWDLAYCSRSGRPSDPWLEPDIIDHLRSLPEQGVQSVVVAPIGFVA
FT                   DHMEVVNDLDYEAAEAAKESGLAFTRAATAGTHPAFIADLAGLILSQAAAARGEGGNLT
FT                   SWPAPCVAGCCRRYPDAQDIPAVSGGDVESVAAGADVVDAEPGGVDFVPSGSASAVDRP
FT                   GPEAVELETPPSPYNPLTKEAPMSDHSSADSVIEGPRDDEVPAGSYTAPTDPRDTPVIP
FT                   EEVNASSKWAMYSVFRVATALPAEDDERRRLVEGSDEWAGQSGVDTRGWYDLSGLRANA
FT                   DLLVWWVSDDPAVLQDAYHRFRASGLGRHLEPVWSNVGVHRPAEFNKSHLPSCFAGIAP
FT                   RRWAAFYPFIRSKEWYLLPAADRSRMLREHGIVGAASSDVKASTLAAFALGDYEWILAL
FT                   EGDDLARIVDVMKDLRYVEARRYVDVDTPFFTGERVSPVVWADRQMRA"
     MTANPYAAPT DPLAPYSAVL VVSFGGPRSP EEVMPFLRRV SHGRIPEERL ADVARHYDRF        60
     GGVSPINDAT DVFVNAIGNE LRRHGVRVPV LLGNRNGTPF LEEALTDMHA HGVRRVLAVV       120
     TSAYASYSGC RQYREEIATA LAHAGITDMQ VDKVPPFNEA PGFIRANAEA LMQAFMRIPP       180
     TPLEATRVVF VTHSIPDSMQ DASGAGQPGT DYISQHKAVC ERVAGQVRQV FGNMPQWDLA       240
     YCSRSGRPSD PWLEPDIIDH LRSLPEQGVQ SVVVAPIGFV ADHMEVVNDL DYEAAEAAKE       300
     SGLAFTRAAT AGTHPAFIAD LAGLILSQAA AARGEGGNLT SWPAPCVAGC CRRYPDAQDI       360
     PAVSGGDVES VAAGADVVDA EPGGVDFVPS GSASAVDRPG PEAVELETPP SPYNPLTKEA       420
     PMSDHSSADS VIEGPRDDEV PAGSYTAPTD PRDTPVIPEE VNASSKWAMY SVFRVATALP       480
     AEDDERRRLV EGSDEWAGQS GVDTRGWYDL SGLRANADLL VWWVSDDPAV LQDAYHRFRA       540
     SGLGRHLEPV WSNVGVHRPA EFNKSHLPSC FAGIAPRRWA AFYPFIRSKE WYLLPAADRS       600
     RMLREHGIVG AASSDVKAST LAAFALGDYE WILALEGDDL ARIVDVMKDL RYVEARRYVD       660
     VDTPFFTGER VSPVVWADRQ MRA                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page