(data stored in ACNUC30630 zone)

EMBL: CP001977.PE349

CP001977.PE349       Location/Qualifiers
FT   CDS             complement(388051..388689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99206"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL6"
FT                   /protein_id="ADD99206.1"
FT                   /translation="MHVDHLMFAAGPAGLDEDAARLGEILGTSFINGGVHPSFGTRNRI
FT                   LPLSGPRYIEIVEVLDHPAAEKAVFGQAVRARQEQGGGWMGWAVSVDDLAPYEKRLERQ
FT                   SVPGKRTFPDGRHLEWRQIGIKGLMADPQLPFFIKWTSPTELLPSSLSGNVTLTSVEMS
FT                   GSRQRVEDWLGETIPDEVDGITFNFASPNGHPGIDAVTFDTPSRGCVRI"
     MHVDHLMFAA GPAGLDEDAA RLGEILGTSF INGGVHPSFG TRNRILPLSG PRYIEIVEVL        60
     DHPAAEKAVF GQAVRARQEQ GGGWMGWAVS VDDLAPYEKR LERQSVPGKR TFPDGRHLEW       120
     RQIGIKGLMA DPQLPFFIKW TSPTELLPSS LSGNVTLTSV EMSGSRQRVE DWLGETIPDE       180
     VDGITFNFAS PNGHPGIDAV TFDTPSRGCV RI                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page