(data stored in ACNUC30630 zone)

EMBL: CP001977.PE355

CP001977.PE355       Location/Qualifiers
FT   CDS             393469..393636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3362"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08213"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00515"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM2"
FT                   /protein_id="ADE00515.1"
FT                   /translation="MGQELRTYLGAPSFQFQRKRLTVGSVIKKRRKRMAKKKHRKLLKK
FT                   TRIQRRRAGK"
     MGQELRTYLG APSFQFQRKR LTVGSVIKKR RKRMAKKKHR KLLKKTRIQR RRAGK             55
//

If you have problems or comments...

PBIL Back to PBIL home page