(data stored in ACNUC30630 zone)

EMBL: CP001977.PE364

CP001977.PE364       Location/Qualifiers
FT   CDS             complement(401840..402634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3371"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00034"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN1"
FT                   /protein_id="ADE00034.1"
FT                   /translation="MNDMEATRDERPWALVSGASGGLGQAFSRHLASCGVNLVVTGRRH
FT                   DVLDDLADQLTTRYGIQTIVHPCDISSASERLALVNEIAGRGIIIDTLVNNAGFGAAGR
FT                   IAETDPERQTSQVEVNCEAVVHLCGLLLPGMITAKRGSIINVASTAAFQPIPQFATYAA
FT                   SKSFVLSFTRALWAETNGTGVRATAICPGPTETGFFDVAGVPRMAAGARRDPDDVVRTA
FT                   FDALARHRPYAVDGFVNRTVARLAPHLPARLVMTQAEKYLQV"
     MNDMEATRDE RPWALVSGAS GGLGQAFSRH LASCGVNLVV TGRRHDVLDD LADQLTTRYG        60
     IQTIVHPCDI SSASERLALV NEIAGRGIII DTLVNNAGFG AAGRIAETDP ERQTSQVEVN       120
     CEAVVHLCGL LLPGMITAKR GSIINVASTA AFQPIPQFAT YAASKSFVLS FTRALWAETN       180
     GTGVRATAIC PGPTETGFFD VAGVPRMAAG ARRDPDDVVR TAFDALARHR PYAVDGFVNR       240
     TVARLAPHLP ARLVMTQAEK YLQV                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page