(data stored in ACNUC30630 zone)

EMBL: CP001977.PE376

CP001977.PE376       Location/Qualifiers
FT   CDS             complement(414763..415704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3384"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99826"
FT                   /db_xref="GOA:D4HAP3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP3"
FT                   /protein_id="ADD99826.1"
FT                   /translation="MGGHKGPIQAAGAVVLRDIDDGAREVLVVHRPSYDDLSLPKGKLE
FT                   PGEDLPTTAVREVAEETGINIRLTMPLQPIEYTVKYSTRDGKPKSRAKVVSWWLGVAIG
FT                   GSIENATASPEEIDGAFWMPTDQALERLTYPTDVQVLEEALDLPSTSTIILVRHGKAVS
FT                   RKEWNSRKRHGKDATRPLERRGRRQAKALADLLSAFGVARLASSSSTRCMQTLQPYADT
FT                   IGAQITGLDALSEETHEADPHKATSAMRKIIGRALADPNQPIAICGHRPVLPTMRDALG
FT                   GANRPMSTAECLIVHLDETGRTIRQEWHSSRY"
     MGGHKGPIQA AGAVVLRDID DGAREVLVVH RPSYDDLSLP KGKLEPGEDL PTTAVREVAE        60
     ETGINIRLTM PLQPIEYTVK YSTRDGKPKS RAKVVSWWLG VAIGGSIENA TASPEEIDGA       120
     FWMPTDQALE RLTYPTDVQV LEEALDLPST STIILVRHGK AVSRKEWNSR KRHGKDATRP       180
     LERRGRRQAK ALADLLSAFG VARLASSSST RCMQTLQPYA DTIGAQITGL DALSEETHEA       240
     DPHKATSAMR KIIGRALADP NQPIAICGHR PVLPTMRDAL GGANRPMSTA ECLIVHLDET       300
     GRTIRQEWHS SRY                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page