(data stored in ACNUC30630 zone)

EMBL: CP001977.PE381

CP001977.PE381       Location/Qualifiers
FT   CDS             420243..420743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3389"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08768"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00824"
FT                   /db_xref="GOA:D4HAP8"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP8"
FT                   /protein_id="ADE00824.1"
FT                   /translation="MPFQIPDDLNRDLMPLAWMIGHWEGEGHGNTPDDGEFSFGCQVDF
FT                   TDNGGDYLHYICQTFTMNPDGTPAAPLRMETGFWRPNVDTRKVDVLMAAPEGWAEVWTG
FT                   NIDGAKIELVTDAVARTEEALVPYTGGQRLYGQVEGDLLWTFDRATVDAPLQPYMWARL
FT                   KRS"
     MPFQIPDDLN RDLMPLAWMI GHWEGEGHGN TPDDGEFSFG CQVDFTDNGG DYLHYICQTF        60
     TMNPDGTPAA PLRMETGFWR PNVDTRKVDV LMAAPEGWAE VWTGNIDGAK IELVTDAVAR       120
     TEEALVPYTG GQRLYGQVEG DLLWTFDRAT VDAPLQPYMW ARLKRS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page