(data stored in ACNUC30630 zone)

EMBL: CP001977.PE391

CP001977.PE391       Location/Qualifiers
FT   CDS             428878..429438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00806"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB39"
FT                   /protein_id="ADE00806.1"
FT                   /translation="MDADSAKLNDDMRPGRGDSTMIDRRRTTAVLAAVGVLGVVACGAD
FT                   PKVFTSYTPAAGVNGKSDTVKVQNLVLINGGGQARVSAAVVSRKDDKIVGITGEPLTSN
FT                   NSLSGRSFTMRTVNVKLPAQTSVNLTQSKLQVPVEGLSNGLLAKVTIKFANSAPVTLDA
FT                   PVVSSTHPDFAEYAPSGIPSARS"
     MDADSAKLND DMRPGRGDST MIDRRRTTAV LAAVGVLGVV ACGADPKVFT SYTPAAGVNG        60
     KSDTVKVQNL VLINGGGQAR VSAAVVSRKD DKIVGITGEP LTSNNSLSGR SFTMRTVNVK       120
     LPAQTSVNLT QSKLQVPVEG LSNGLLAKVT IKFANSAPVT LDAPVVSSTH PDFAEYAPSG       180
     IPSARS                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page