(data stored in ACNUC30630 zone)

EMBL: CP001977.PE398

CP001977.PE398       Location/Qualifiers
FT   CDS             complement(434360..434818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3406"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00491"
FT                   /db_xref="GOA:D4HB46"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB46"
FT                   /protein_id="ADE00491.1"
FT                   /translation="MPTPRLIVADVTATSQNDLYAQVNDRLTADNMVKSTFLNAVSARE
FT                   KKFPTGLDFGYVSIAIPHIDPEHVISPGLLVCRNSASTTFHAMDDPERNLDVQLSIWPL
FT                   VTDPGNQIDMLEAVITLIQDESSYRILLHGSHAEVANTLPDVLATVED"
     MPTPRLIVAD VTATSQNDLY AQVNDRLTAD NMVKSTFLNA VSAREKKFPT GLDFGYVSIA        60
     IPHIDPEHVI SPGLLVCRNS ASTTFHAMDD PERNLDVQLS IWPLVTDPGN QIDMLEAVIT       120
     LIQDESSYRI LLHGSHAEVA NTLPDVLATV ED                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page