(data stored in ACNUC30630 zone)

EMBL: CP001977.PE417

CP001977.PE417       Location/Qualifiers
FT   CDS             453573..454127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00706"
FT                   /db_xref="GOA:D4HB65"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB65"
FT                   /protein_id="ADE00706.1"
FT                   /translation="MSKQYVSPPLIRRPSRTLPVTILAVVLLAAGVVAIIAAIQRLQHG
FT                   SLPQWVAWGRGHMTTASWLNDTALTVAIVIGVVALLFLIWAFKPGRTSGVFLQPSEGAP
FT                   DNREIVMDNSDLTGWLSRWLDEEDGVASSVVKRRGKTLKVHAETDVKDPEVMREQLTTR
FT                   IAARVDSLGLEQPLKVEVRLR"
     MSKQYVSPPL IRRPSRTLPV TILAVVLLAA GVVAIIAAIQ RLQHGSLPQW VAWGRGHMTT        60
     ASWLNDTALT VAIVIGVVAL LFLIWAFKPG RTSGVFLQPS EGAPDNREIV MDNSDLTGWL       120
     SRWLDEEDGV ASSVVKRRGK TLKVHAETDV KDPEVMREQL TTRIAARVDS LGLEQPLKVE       180
     VRLR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page