(data stored in ACNUC30630 zone)

EMBL: CP001977.PE439

CP001977.PE439       Location/Qualifiers
FT   CDS             475238..475987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3447"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00739"
FT                   /db_xref="GOA:D4HB87"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB87"
FT                   /protein_id="ADE00739.1"
FT                   /translation="MITYALLDIRRLLRNTGGTIFTVLMPAGFYLIFGATQSYTDAAVA
FT                   HGNVKATIMVSMAVYGAVLAVTTWGSHAALEQQRGWGRQLALTPMTPLKYVFSKVLAIE
FT                   TVALVPLAVVFATGAITNARVDGLRWLWSFLLCWVCSMPFTLFGLAVALLVRGEAATGI
FT                   TSFCTVAVAFLGNMFIPLNGFMLKLSRFTPMYGPGQLTRMPLIGQQMVTMRGVIDEPVW
FT                   CPVVSIIAWTIIMGIVAVLAGRRRQNR"
     MITYALLDIR RLLRNTGGTI FTVLMPAGFY LIFGATQSYT DAAVAHGNVK ATIMVSMAVY        60
     GAVLAVTTWG SHAALEQQRG WGRQLALTPM TPLKYVFSKV LAIETVALVP LAVVFATGAI       120
     TNARVDGLRW LWSFLLCWVC SMPFTLFGLA VALLVRGEAA TGITSFCTVA VAFLGNMFIP       180
     LNGFMLKLSR FTPMYGPGQL TRMPLIGQQM VTMRGVIDEP VWCPVVSIIA WTIIMGIVAV       240
     LAGRRRQNR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page