(data stored in ACNUC30630 zone)

EMBL: CP001977.PE44

CP001977.PE44        Location/Qualifiers
FT   CDS             41774..41986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3044"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00329"
FT                   /db_xref="GOA:D4HEK2"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK2"
FT                   /protein_id="ADE00329.1"
FT                   /translation="MTKEVAMKHVNTVASVVLPMIAGIPPLVEKRDERGLSQSTENAIL
FT                   LVGAVSIATVVVTVIKGYVSSNLPK"
     MTKEVAMKHV NTVASVVLPM IAGIPPLVEK RDERGLSQST ENAILLVGAV SIATVVVTVI        60
     KGYVSSNLPK                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page