(data stored in ACNUC30630 zone)

EMBL: CP001977.PE450

CP001977.PE450       Location/Qualifiers
FT   CDS             488780..488974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3459"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00505"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB98"
FT                   /protein_id="ADE00505.1"
FT                   /translation="MNPGLLRSGDGDDVGETTGSDPGKGRPRVIRSPKTPMHGAVSFGS
FT                   RIKVLAPRRNCHALIEAIG"
     MNPGLLRSGD GDDVGETTGS DPGKGRPRVI RSPKTPMHGA VSFGSRIKVL APRRNCHALI        60
     EAIG                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page