(data stored in ACNUC30630 zone)

EMBL: CP001977.PE451

CP001977.PE451       Location/Qualifiers
FT   CDS             488994..490013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3460"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99662"
FT                   /db_xref="GOA:D4HB99"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB99"
FT                   /protein_id="ADD99662.1"
FT                   /translation="MAPLLLVLVVLIVVSAVISLAIGSEPLPLRGVLDTVGARVTGQPG
FT                   PDPTIDVIVWDLRAPRALLAVIVGAGLALAGSGMQTLVRNPLADPYLLGVSAGASVGAT
FT                   AVIALGMFTSWGTHRLTLGALVGALAAAALVYLISMAQGGMTPLRLVLSGVVLSSAFSA
FT                   LASFLVFRSPDPRAAQSVLFWMLGSVAGATWDSLWVAALVTVVIAVLMIAFSGWLDALA
FT                   AGTDVARSLGIPDTRVRKALFVGNSVLVGVLVAVSGGIGFVGLVIPHMARLLVGASHRS
FT                   MLPIAAAVGSLFLLWVDVGARVIAAPQEVPLGVVTGFIGAPIFLYLMGRSQYRFSSES"
     MAPLLLVLVV LIVVSAVISL AIGSEPLPLR GVLDTVGARV TGQPGPDPTI DVIVWDLRAP        60
     RALLAVIVGA GLALAGSGMQ TLVRNPLADP YLLGVSAGAS VGATAVIALG MFTSWGTHRL       120
     TLGALVGALA AAALVYLISM AQGGMTPLRL VLSGVVLSSA FSALASFLVF RSPDPRAAQS       180
     VLFWMLGSVA GATWDSLWVA ALVTVVIAVL MIAFSGWLDA LAAGTDVARS LGIPDTRVRK       240
     ALFVGNSVLV GVLVAVSGGI GFVGLVIPHM ARLLVGASHR SMLPIAAAVG SLFLLWVDVG       300
     ARVIAAPQEV PLGVVTGFIG APIFLYLMGR SQYRFSSES                              339
//

If you have problems or comments...

PBIL Back to PBIL home page