(data stored in ACNUC30630 zone)

EMBL: CP001977.PE46

CP001977.PE46        Location/Qualifiers
FT   CDS             42360..42869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00319"
FT                   /db_xref="GOA:D4HEK4"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK4"
FT                   /protein_id="ADE00319.1"
FT                   /translation="MIRPFHGRALLPQDRIDQIRYRRCNACQNRRHWCCRGAVAVEAAL
FT                   ILPALLMIAAVATGSWRISEVKADAQSAAQVAARAGSVASSVGEGIAVGQRVGLAELAG
FT                   TRCSNPAIAVDSSDLTLPVGFAGTASARVSCTIKLSDLLVPGMPGSFHIESVAHSTLDS
FT                   HRERYS"
     MIRPFHGRAL LPQDRIDQIR YRRCNACQNR RHWCCRGAVA VEAALILPAL LMIAAVATGS        60
     WRISEVKADA QSAAQVAARA GSVASSVGEG IAVGQRVGLA ELAGTRCSNP AIAVDSSDLT       120
     LPVGFAGTAS ARVSCTIKLS DLLVPGMPGS FHIESVAHST LDSHRERYS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page