(data stored in ACNUC30630 zone)

EMBL: CP001977.PE460

CP001977.PE460       Location/Qualifiers
FT   CDS             497079..497768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99391"
FT                   /db_xref="GOA:D4HBP2"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP2"
FT                   /protein_id="ADD99391.1"
FT                   /translation="MDPMNRSSSSAALLVGAVAVPIAVCAVLSALIDVFVAPAAALVLV
FT                   LVIVIVCLRGSWLVDALVIVVSAIGFDFFLTYPYRSMKIASRPDIEVTIVLFVVGAAIA
FT                   GISRWALTASDLAERRQGYVTYALDARSGDMSRDEVAQRLAGLVGAEAGAWVDGAPPSG
FT                   EAVIQDATAMRTDVGLEDPSRVGFPTDRFICFPAAGGYIRISAASRHVRPTAEQMRAAC
FT                   LLASQIS"
     MDPMNRSSSS AALLVGAVAV PIAVCAVLSA LIDVFVAPAA ALVLVLVIVI VCLRGSWLVD        60
     ALVIVVSAIG FDFFLTYPYR SMKIASRPDI EVTIVLFVVG AAIAGISRWA LTASDLAERR       120
     QGYVTYALDA RSGDMSRDEV AQRLAGLVGA EAGAWVDGAP PSGEAVIQDA TAMRTDVGLE       180
     DPSRVGFPTD RFICFPAAGG YIRISAASRH VRPTAEQMRA ACLLASQIS                   229
//

If you have problems or comments...

PBIL Back to PBIL home page