(data stored in ACNUC30630 zone)

EMBL: CP001977.PE47

CP001977.PE47        Location/Qualifiers
FT   CDS             42866..45628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3047"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01254"
FT                   /db_xref="GOA:D4HEK5"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK5"
FT                   /protein_id="ADE01254.1"
FT                   /translation="MKISPVRARIHGALAMVALLLLVVGSPAALVAWGHLDATTVLSPA
FT                   GWLAPDDGSIFLTVVTVIGWAAWTVFCVCVVAEAVGMATSQRHHVKLPGLGAIQGIAAG
FT                   LLVASLTVLSPLTRSAVPPAPVSLVATAAAAPQPAPEAQVDSDSRHDEDVMTVTVGPHD
FT                   DLWTLAETWYGDGTSWRRIVAANPDVDVDHLVVGQRLALPGATVTVPAGHTGAGRPIDT
FT                   EQLNQIAPPSEMSKIRTITVEQGDTLSGIAQTQLGDASSWPAIWHLNEGIIADPDHIEP
FT                   GWELVLPDSPTVDKRASDQHTNEQGGKWEKSTPAETPTTESTPPVLPEGGGDTTATVNE
FT                   TKVEPHTAAGADQEVSVAEVGQSPAEILRTALAGLSLFLAGGVAGTVTTRRRQQLFTRP
FT                   LGRRIPPVSGEPRRAKRVLDAAADQLDESASSRDTAALAMTPTTVVLGTCDPQTPVVVD
FT                   LADVGGVLAVNAARDLATAMVASISLSLVAAPWSGGIDIVAVGEDLAWLAHTGSDDVQL
FT                   ADEDEIVEGLAGLSNEASEYPATITRVVLSLSPLNLPSPASLAAAGIVIVMPGVGGQKI
FT                   TVTDCDHAEFHGQSFTPQIVTSPMRRAVVELLETTARSDTEPAPWWEPRRGDEEGSDPP
FT                   PVMDKPCAVLPPSDAHLTVEEETVLTSTMTSDVAHLPATGGQVPSPILRLLGPVDLLGA
FT                   RGNPPTKARRQCLEYCAWLLCHPGARSVQMADALMVAEPTRRSNVSRLRRWLGTDDAGR
FT                   AYLPEGYDGSLRLADAVTSDWERLELLVSGGVSTAPLANLVSALDLVRGAPLADAAPGQ
FT                   WHWAEEWRIDMIQMVRDIGVEVARRAMEIRDVELASRALARATVACPEDEVLLVARIKL
FT                   ADELDDRGEVERLVYVLSRQARRLGVDLSEETITVLQEVMEGHARARVV"
     MKISPVRARI HGALAMVALL LLVVGSPAAL VAWGHLDATT VLSPAGWLAP DDGSIFLTVV        60
     TVIGWAAWTV FCVCVVAEAV GMATSQRHHV KLPGLGAIQG IAAGLLVASL TVLSPLTRSA       120
     VPPAPVSLVA TAAAAPQPAP EAQVDSDSRH DEDVMTVTVG PHDDLWTLAE TWYGDGTSWR       180
     RIVAANPDVD VDHLVVGQRL ALPGATVTVP AGHTGAGRPI DTEQLNQIAP PSEMSKIRTI       240
     TVEQGDTLSG IAQTQLGDAS SWPAIWHLNE GIIADPDHIE PGWELVLPDS PTVDKRASDQ       300
     HTNEQGGKWE KSTPAETPTT ESTPPVLPEG GGDTTATVNE TKVEPHTAAG ADQEVSVAEV       360
     GQSPAEILRT ALAGLSLFLA GGVAGTVTTR RRQQLFTRPL GRRIPPVSGE PRRAKRVLDA       420
     AADQLDESAS SRDTAALAMT PTTVVLGTCD PQTPVVVDLA DVGGVLAVNA ARDLATAMVA       480
     SISLSLVAAP WSGGIDIVAV GEDLAWLAHT GSDDVQLADE DEIVEGLAGL SNEASEYPAT       540
     ITRVVLSLSP LNLPSPASLA AAGIVIVMPG VGGQKITVTD CDHAEFHGQS FTPQIVTSPM       600
     RRAVVELLET TARSDTEPAP WWEPRRGDEE GSDPPPVMDK PCAVLPPSDA HLTVEEETVL       660
     TSTMTSDVAH LPATGGQVPS PILRLLGPVD LLGARGNPPT KARRQCLEYC AWLLCHPGAR       720
     SVQMADALMV AEPTRRSNVS RLRRWLGTDD AGRAYLPEGY DGSLRLADAV TSDWERLELL       780
     VSGGVSTAPL ANLVSALDLV RGAPLADAAP GQWHWAEEWR IDMIQMVRDI GVEVARRAME       840
     IRDVELASRA LARATVACPE DEVLLVARIK LADELDDRGE VERLVYVLSR QARRLGVDLS       900
     EETITVLQEV MEGHARARVV                                                   920
//

If you have problems or comments...

PBIL Back to PBIL home page