(data stored in ACNUC30630 zone)

EMBL: CP001977.PE482

CP001977.PE482       Location/Qualifiers
FT   CDS             complement(517918..518994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3492"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01199"
FT                   /db_xref="GOA:D4HBR4"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR4"
FT                   /protein_id="ADE01199.1"
FT                   /translation="MKINYTPGPLLDASRTTPTALWNDSADLDELRQSIAFGGVGATCN
FT                   PVIGYTTIKKHPDIWEDRIRAIAENNPTWGESQIGWQAIKDMSVEAAKLLEPIFVEHKG
FT                   RNGRLSIQTDPRLHRDAKALADQAEEFSNLAPNIIVKIPCTSVGIEAIEEATYRGVSVN
FT                   VTVSFTVPQAVKSAEAIERGLQRRVAEGKPIDEMGPVVTIMAGRLDDWLKIVAERDRLF
FT                   IDPGHLEWAGIAAIKRANQIFVERGFHSRVLCAAFRNVLQWSELIGGDLVVSPPFKWQK
FT                   RINDSDYHVVPRIDEPVAAEHLDALKKIPEFMRAYDPDGMTIKEFDTFGATRRTLRQFL
FT                   QADADLDTLVRDIITPAI"
     MKINYTPGPL LDASRTTPTA LWNDSADLDE LRQSIAFGGV GATCNPVIGY TTIKKHPDIW        60
     EDRIRAIAEN NPTWGESQIG WQAIKDMSVE AAKLLEPIFV EHKGRNGRLS IQTDPRLHRD       120
     AKALADQAEE FSNLAPNIIV KIPCTSVGIE AIEEATYRGV SVNVTVSFTV PQAVKSAEAI       180
     ERGLQRRVAE GKPIDEMGPV VTIMAGRLDD WLKIVAERDR LFIDPGHLEW AGIAAIKRAN       240
     QIFVERGFHS RVLCAAFRNV LQWSELIGGD LVVSPPFKWQ KRINDSDYHV VPRIDEPVAA       300
     EHLDALKKIP EFMRAYDPDG MTIKEFDTFG ATRRTLRQFL QADADLDTLV RDIITPAI         358
//

If you have problems or comments...

PBIL Back to PBIL home page