(data stored in ACNUC30630 zone)

EMBL: CP001977.PE492

CP001977.PE492       Location/Qualifiers
FT   CDS             529410..530408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3502"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00138"
FT                   /db_xref="GOA:D4HBS4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS4"
FT                   /protein_id="ADE00138.1"
FT                   /translation="MSMNIGAYTACLHNYDLAEALDILKTNGLTGAEVNVGGFIPSPHC
FT                   PVDTLMTSQTAREDYMGIFEDKEMRLAGLNTSGNPLSPLPDVGPRHAYDLRRAIELAGK
FT                   LGITDLVCMSGTPGSDRHAKYPSWVVNPWNGVELEVLEYQKSVVDPFWREMDLRAQNAG
FT                   VKLALELHPHNLVFTPVNFLEFAERIDARNIGVNMDPSHLMWQGMDIIAAIELLGDHIF
FT                   HVHAKDTVILPGIATRGVLDSSFGPVPDDPDVRVQTGMEHYCSSWPSDPAWRFVAIGNG
FT                   HDVTWWTNFLRAIRDVNPGMNINIEHEDQSLAQLDGIAVSARNLLAAEQAV"
     MSMNIGAYTA CLHNYDLAEA LDILKTNGLT GAEVNVGGFI PSPHCPVDTL MTSQTAREDY        60
     MGIFEDKEMR LAGLNTSGNP LSPLPDVGPR HAYDLRRAIE LAGKLGITDL VCMSGTPGSD       120
     RHAKYPSWVV NPWNGVELEV LEYQKSVVDP FWREMDLRAQ NAGVKLALEL HPHNLVFTPV       180
     NFLEFAERID ARNIGVNMDP SHLMWQGMDI IAAIELLGDH IFHVHAKDTV ILPGIATRGV       240
     LDSSFGPVPD DPDVRVQTGM EHYCSSWPSD PAWRFVAIGN GHDVTWWTNF LRAIRDVNPG       300
     MNINIEHEDQ SLAQLDGIAV SARNLLAAEQ AV                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page