(data stored in ACNUC30630 zone)

EMBL: CP001977.PE506

CP001977.PE506       Location/Qualifiers
FT   CDS             542014..542169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT8"
FT                   /protein_id="ADE00259.1"
FT                   /translation="MSAHAYWEYIQFQGRPVTVFTTVTGAASSGSVATIVRVDLASHDI
FT                   GWVHRR"
     MSAHAYWEYI QFQGRPVTVF TTVTGAASSG SVATIVRVDL ASHDIGWVHR R                 51
//

If you have problems or comments...

PBIL Back to PBIL home page