(data stored in ACNUC30630 zone)

EMBL: CP001977.PE512

CP001977.PE512       Location/Qualifiers
FT   CDS             complement(547429..547701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00880"
FT                   /db_xref="GOA:D4HBU4"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU4"
FT                   /protein_id="ADE00880.1"
FT                   /translation="MTCHNNVAGHYDGAVSNHHLLTQANVAPVDENGVTVGIVGTIAFA
FT                   VASLICWIMLDRLTETGYRDWLWICLTGTGLGVVGTAYCWQRSRH"
     MTCHNNVAGH YDGAVSNHHL LTQANVAPVD ENGVTVGIVG TIAFAVASLI CWIMLDRLTE        60
     TGYRDWLWIC LTGTGLGVVG TAYCWQRSRH                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page