(data stored in ACNUC30630 zone)

EMBL: CP001977.PE514

CP001977.PE514       Location/Qualifiers
FT   CDS             complement(549203..549913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00363"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU6"
FT                   /protein_id="ADE00363.1"
FT                   /translation="MGGLRFNAIAIDEVRDIFGADEGLAMKLRRWAEARFSVPVHHHRR
FT                   PRWRSPFHPLYKPNVECSMLPTGWPTPHDVEDLVCGRYIESDRSARCWRLVNEWLTHLS
FT                   WGWTEIPMSVARFEELDRDLAAAGLPSTYSLKRLMDEDPQIPLRPAPGMKIGYAGTRQI
FT                   LATWVELSEVIGTVPIARRGEVNAVLKFLSSYPGWNHLAVDLGRPAPGLLVVWQPDTVE
FT                   DAHPTGLRAGRTAS"
     MGGLRFNAIA IDEVRDIFGA DEGLAMKLRR WAEARFSVPV HHHRRPRWRS PFHPLYKPNV        60
     ECSMLPTGWP TPHDVEDLVC GRYIESDRSA RCWRLVNEWL THLSWGWTEI PMSVARFEEL       120
     DRDLAAAGLP STYSLKRLMD EDPQIPLRPA PGMKIGYAGT RQILATWVEL SEVIGTVPIA       180
     RRGEVNAVLK FLSSYPGWNH LAVDLGRPAP GLLVVWQPDT VEDAHPTGLR AGRTAS           236
//

If you have problems or comments...

PBIL Back to PBIL home page