(data stored in ACNUC30630 zone)

EMBL: CP001977.PE528

CP001977.PE528       Location/Qualifiers
FT   CDS             complement(561492..562079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3539"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99072"
FT                   /db_xref="GOA:D4HC06"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC06"
FT                   /protein_id="ADD99072.1"
FT                   /translation="MDPRSGKEELRRRCLAHRAALDHRTRMSRDDRRTEHAMSRLLWAH
FT                   KVALYLSRGDEPDTVDLADTLIMMGKKVLAPVLTDGHGRSLHEPAWAWYDSKNVRTGLW
FT                   QIPEPIAPILPASAIDQVEVVLCSALFVDRSGYRVGVGGGWYDRVLAHRADDVPVWAVV
FT                   NDDEILDEVPHDPWDESVTAALTPSGLHMLGQ"
     MDPRSGKEEL RRRCLAHRAA LDHRTRMSRD DRRTEHAMSR LLWAHKVALY LSRGDEPDTV        60
     DLADTLIMMG KKVLAPVLTD GHGRSLHEPA WAWYDSKNVR TGLWQIPEPI APILPASAID       120
     QVEVVLCSAL FVDRSGYRVG VGGGWYDRVL AHRADDVPVW AVVNDDEILD EVPHDPWDES       180
     VTAALTPSGL HMLGQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page