(data stored in ACNUC30630 zone)

EMBL: CP001977.PE534

CP001977.PE534       Location/Qualifiers
FT   CDS             complement(566948..568237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3546"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454; match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99344"
FT                   /db_xref="GOA:D4HC12"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC12"
FT                   /protein_id="ADD99344.1"
FT                   /translation="MSIARHLQLVSSLATAPKTVELPLAECLGLVSAEPVTARLTVPPF
FT                   TNSAMDGFAVRHADVSEATVHTPVTLPVTNDVPAGSPAHRPLDPGTAQRIMTGARMPEN
FT                   ADTVIKVEDTDHAPGTVDAPATVTIFRTPSTGANVRRRGEALATGATVLPAGRRLTPEA
FT                   LAAAAAVGHGSLRVHPAPRVGVLATGSELGGAGEPLHRGKIPDSNGIMLGGLVRTHGGV
FT                   VEQTRVPDDPERLRELVRSWRVDLIVTAGGISMGAYEVVRQGLPELTFHHVAQQPGGPQ
FT                   GAGMVAETPVLALPGNPVGAYVSFHVYVAPLLARLRGLSPDLIDATPAGVTAPIDPLLG
FT                   RRLVRARAGAPWRSPAAKTQFMPVCWNGENVEPVHALGSKSHLVTSLPLVEGLAVAGPG
FT                   IDHVDSGDELSILLTGGVTHDLKPIHPPAW"
     MSIARHLQLV SSLATAPKTV ELPLAECLGL VSAEPVTARL TVPPFTNSAM DGFAVRHADV        60
     SEATVHTPVT LPVTNDVPAG SPAHRPLDPG TAQRIMTGAR MPENADTVIK VEDTDHAPGT       120
     VDAPATVTIF RTPSTGANVR RRGEALATGA TVLPAGRRLT PEALAAAAAV GHGSLRVHPA       180
     PRVGVLATGS ELGGAGEPLH RGKIPDSNGI MLGGLVRTHG GVVEQTRVPD DPERLRELVR       240
     SWRVDLIVTA GGISMGAYEV VRQGLPELTF HHVAQQPGGP QGAGMVAETP VLALPGNPVG       300
     AYVSFHVYVA PLLARLRGLS PDLIDATPAG VTAPIDPLLG RRLVRARAGA PWRSPAAKTQ       360
     FMPVCWNGEN VEPVHALGSK SHLVTSLPLV EGLAVAGPGI DHVDSGDELS ILLTGGVTHD       420
     LKPIHPPAW                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page