(data stored in ACNUC30630 zone)

EMBL: CP001977.PE536

CP001977.PE536       Location/Qualifiers
FT   CDS             complement(568702..568941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3548"
FT                   /product="ThiS family protein"
FT                   /note="identified by match to protein family HMM PF02597"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99921"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC14"
FT                   /protein_id="ADD99921.1"
FT                   /translation="MQVHYYGGTAEAAGTSEETVETPTGLSVNQLLDHLRNLHPGLGRL
FT                   LGVCTLFVDGSAVRGEQIVPARAQVEVLPPFAGG"
     MQVHYYGGTA EAAGTSEETV ETPTGLSVNQ LLDHLRNLHP GLGRLLGVCT LFVDGSAVRG        60
     EQIVPARAQV EVLPPFAGG                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page