(data stored in ACNUC30630 zone)

EMBL: CP001977.PE545

CP001977.PE545       Location/Qualifiers
FT   CDS             complement(576930..580667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3557"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM TIGR01580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01214"
FT                   /db_xref="GOA:D4HC23"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC23"
FT                   /protein_id="ADE01214.1"
FT                   /translation="MTEYDETSDAESPSGSALLKMGTWLRRGTTSPDTRQLFLEGGRDA
FT                   DVFYRKCWSHDKVVRSTHGVNCTGSCSWKIYVKEGIISWESQQTDYPSTGPDMPDYEPR
FT                   GCPRGASFSWYEYSPTRIRHPYVRSVLLDAWRDKLAEFGDPVDAWASITNDPELSQAYK
FT                   CARGHGGMVRVSWEEATQIIAAAYVHTIKAYGPDRIAGFSVIPAMSMVSYGAGSRFTEL
FT                   LGGTMLSFYDWYADLPPASPQVFGDQTDVPEAGDWFNSQYLIMWGSNVPVTRTPDAHFM
FT                   TEARYHGQKVVVVSPDYADNTKFADEWLRVASGTDGALAMAMGHVILSEFHVTRREPMF
FT                   LDYMRRYTDSPFLVELDRFDGPQADGAAYVPGKFLTADKVNLQTRPDHPEFRPLVMEAD
FT                   GSLKDPGGTLADRFSESGVGHWNLDLDGVNPVMSMMDVNSWEAVEIALPRFDLPSSPDQ
FT                   TSLGAGIVHRGVPARRIGDRLVTTVYDLLLAQYAVSREGLPGQWPSGYDDPTVPGTPAW
FT                   QAELTGVPAAAAERIGREFALNSLETGGRSMIVMGAGVNHFYHADEIYRTFLALTNMCA
FT                   TQGVNGGGWAHYVGQEKVRPFTGWANYSFALDWARPARQMIATAWYYLTTDQWRYDGAR
FT                   AESIASPLGSGSFAGRTTADCMVYSARRGWTPSYPTFTRNPLDLADEAAAAGMEPAEYI
FT                   AQKLTDGSLGFACEDPDATQNYPRLLANWRTNLLGSSAKGTEFFMKHMLGCENDVNATE
FT                   LTEGKRPTDIRWRDDTPPGKLDLMWTADFRNTSTTLHSDVVLPAATWYEKHDLSSTDMH
FT                   PYVHSFNPAVDPPWEARTDFEVFRTLAYSVSQMAVKHLGTRTDIVAAPLMHDTPDEMTT
FT                   PAGSVSREQEAWIPGVTMPKLVTVERDYTQIGAKFDTLGPLTESLGMVTKGVPFHPDPE
FT                   VADLAQRHGVATSGPGAGRPLLDTAIKACDTILATSGTTNGRLATAGFEQLEARTGTKL
FT                   TDLSVGSQDRRVTFTDTVIQPQPVITSPEWSGSEHGGRRYSAFVINMERHKPWHTLTGR
FT                   MHYYLDHDWMRDMGESLPIFRPPLDVAHIYDEPPAGYTGTDADGAAVVSVRYMTPHNKW
FT                   GIHSQYYDNLHMLTLARGGQTIWMSPADAAKIGVSDNDWVEAYNRNGTVDARAIVSHRI
FT                   PEGTVFMYHGQERTVNTPLTERSGKRGGTHNSLTRILLKPSHFIGGYAQLSYAFNYYGP
FT                   TGNQRDEVTLIRRRGQEVTF"
     MTEYDETSDA ESPSGSALLK MGTWLRRGTT SPDTRQLFLE GGRDADVFYR KCWSHDKVVR        60
     STHGVNCTGS CSWKIYVKEG IISWESQQTD YPSTGPDMPD YEPRGCPRGA SFSWYEYSPT       120
     RIRHPYVRSV LLDAWRDKLA EFGDPVDAWA SITNDPELSQ AYKCARGHGG MVRVSWEEAT       180
     QIIAAAYVHT IKAYGPDRIA GFSVIPAMSM VSYGAGSRFT ELLGGTMLSF YDWYADLPPA       240
     SPQVFGDQTD VPEAGDWFNS QYLIMWGSNV PVTRTPDAHF MTEARYHGQK VVVVSPDYAD       300
     NTKFADEWLR VASGTDGALA MAMGHVILSE FHVTRREPMF LDYMRRYTDS PFLVELDRFD       360
     GPQADGAAYV PGKFLTADKV NLQTRPDHPE FRPLVMEADG SLKDPGGTLA DRFSESGVGH       420
     WNLDLDGVNP VMSMMDVNSW EAVEIALPRF DLPSSPDQTS LGAGIVHRGV PARRIGDRLV       480
     TTVYDLLLAQ YAVSREGLPG QWPSGYDDPT VPGTPAWQAE LTGVPAAAAE RIGREFALNS       540
     LETGGRSMIV MGAGVNHFYH ADEIYRTFLA LTNMCATQGV NGGGWAHYVG QEKVRPFTGW       600
     ANYSFALDWA RPARQMIATA WYYLTTDQWR YDGARAESIA SPLGSGSFAG RTTADCMVYS       660
     ARRGWTPSYP TFTRNPLDLA DEAAAAGMEP AEYIAQKLTD GSLGFACEDP DATQNYPRLL       720
     ANWRTNLLGS SAKGTEFFMK HMLGCENDVN ATELTEGKRP TDIRWRDDTP PGKLDLMWTA       780
     DFRNTSTTLH SDVVLPAATW YEKHDLSSTD MHPYVHSFNP AVDPPWEART DFEVFRTLAY       840
     SVSQMAVKHL GTRTDIVAAP LMHDTPDEMT TPAGSVSREQ EAWIPGVTMP KLVTVERDYT       900
     QIGAKFDTLG PLTESLGMVT KGVPFHPDPE VADLAQRHGV ATSGPGAGRP LLDTAIKACD       960
     TILATSGTTN GRLATAGFEQ LEARTGTKLT DLSVGSQDRR VTFTDTVIQP QPVITSPEWS      1020
     GSEHGGRRYS AFVINMERHK PWHTLTGRMH YYLDHDWMRD MGESLPIFRP PLDVAHIYDE      1080
     PPAGYTGTDA DGAAVVSVRY MTPHNKWGIH SQYYDNLHML TLARGGQTIW MSPADAAKIG      1140
     VSDNDWVEAY NRNGTVDARA IVSHRIPEGT VFMYHGQERT VNTPLTERSG KRGGTHNSLT      1200
     RILLKPSHFI GGYAQLSYAF NYYGPTGNQR DEVTLIRRRG QEVTF                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page