(data stored in ACNUC30630 zone)

EMBL: CP001977.PE558

CP001977.PE558       Location/Qualifiers
FT   CDS             complement(592663..592977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3571"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99889"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC36"
FT                   /protein_id="ADD99889.1"
FT                   /translation="MDGHPERLGIIVEQSPNRTQIKRLVDPMNLDPLLAEDLAEGHQRP
FT                   KLERHGEALFLVLHPPFYIDSIEDVAFVEAEVIKQRNCVVPTLIGSIYSMNFDNMPELH
FT                   "
     MDGHPERLGI IVEQSPNRTQ IKRLVDPMNL DPLLAEDLAE GHQRPKLERH GEALFLVLHP        60
     PFYIDSIEDV AFVEAEVIKQ RNCVVPTLIG SIYSMNFDNM PELH                        104
//

If you have problems or comments...

PBIL Back to PBIL home page