(data stored in ACNUC30630 zone)

EMBL: CP001977.PE57

CP001977.PE57        Location/Qualifiers
FT   CDS             complement(56002..56820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3057"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00963"
FT                   /db_xref="GOA:D4HEL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL5"
FT                   /protein_id="ADE00963.1"
FT                   /translation="MHIGAFFRHLFLILGGLISLFPFYWMFVLASRPSSVIYKYPPVLT
FT                   PGNRLGENVHTITDKVNIWAAMANTALVATTVSVLVLLISSLAAFAFAKFDFPGRNVLF
FT                   VIVLATFLLPTQLATIPQFVLMSKIGWVGDLKAVIVPSLASSFGVFWLRQYATNAIPKE
FT                   LLEAATLDGCGFWHQYVHVCLPIIRPAMAFLGIFTFIGSWNDFMWPLIVLNDPSKLTLQ
FT                   VALSQLKTAHGTDYGMLMASSLIAVVPLLVVFVIGAKQLIAGISEGAVKS"
     MHIGAFFRHL FLILGGLISL FPFYWMFVLA SRPSSVIYKY PPVLTPGNRL GENVHTITDK        60
     VNIWAAMANT ALVATTVSVL VLLISSLAAF AFAKFDFPGR NVLFVIVLAT FLLPTQLATI       120
     PQFVLMSKIG WVGDLKAVIV PSLASSFGVF WLRQYATNAI PKELLEAATL DGCGFWHQYV       180
     HVCLPIIRPA MAFLGIFTFI GSWNDFMWPL IVLNDPSKLT LQVALSQLKT AHGTDYGMLM       240
     ASSLIAVVPL LVVFVIGAKQ LIAGISEGAV KS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page