(data stored in ACNUC30630 zone)

EMBL: CP001977.PE571

CP001977.PE571       Location/Qualifiers
FT   CDS             606010..606423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99144"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC49"
FT                   /protein_id="ADD99144.1"
FT                   /translation="MYVTASRRWFKQTDGASVENTTDTAMPVTHTVTVKRSETTEVKGE
FT                   IKADGTLTTYLNQSYGFDYINTVSWELSQKVGPYDLAPHTQGRLVWGFIMLDVDAQNVS
FT                   CGADLTWHAVGKPFSGTNPESRYAELRSEGSIG"
     MYVTASRRWF KQTDGASVEN TTDTAMPVTH TVTVKRSETT EVKGEIKADG TLTTYLNQSY        60
     GFDYINTVSW ELSQKVGPYD LAPHTQGRLV WGFIMLDVDA QNVSCGADLT WHAVGKPFSG       120
     TNPESRYAEL RSEGSIG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page