(data stored in ACNUC30630 zone)

EMBL: CP001977.PE578

CP001977.PE578       Location/Qualifiers
FT   CDS             complement(610285..611424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00376"
FT                   /db_xref="GOA:D4HC56"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC56"
FT                   /protein_id="ADE00376.1"
FT                   /translation="MQYPLTPKPVRRSGALPIVITVLGAIAILLIVALISAGSPVTFIV
FT                   GAIPSTAALIVCLLCYRWLDRWEPEPTRLTVMALIWGGSAGVIFSFLVEMAIPASEFVT
FT                   MAIVAPLAEELAKASVFILVATGARKLELTSLTDHIFYAGICALGFAFVENLGYFALSS
FT                   SAGEFVVMALVRTGFGVFGHPLYTTATAVGIWAWRTKGGLWKAAVGYIAACLLHGLWNG
FT                   GPTLLAGSLGLDDTGQLAAMILVYIVLFVPVFIGTIIMTTRNRRNEYEAVRSQLPLMVE
FT                   AGLVTPAEADMIADPRKRRAILADSGKYGRVAKRNQKRTITAATEAALAQHRIAAGEGG
FT                   PELIKRRDQLSEWLRSRPDKLGQLPLMPQFPPIQPPATW"
     MQYPLTPKPV RRSGALPIVI TVLGAIAILL IVALISAGSP VTFIVGAIPS TAALIVCLLC        60
     YRWLDRWEPE PTRLTVMALI WGGSAGVIFS FLVEMAIPAS EFVTMAIVAP LAEELAKASV       120
     FILVATGARK LELTSLTDHI FYAGICALGF AFVENLGYFA LSSSAGEFVV MALVRTGFGV       180
     FGHPLYTTAT AVGIWAWRTK GGLWKAAVGY IAACLLHGLW NGGPTLLAGS LGLDDTGQLA       240
     AMILVYIVLF VPVFIGTIIM TTRNRRNEYE AVRSQLPLMV EAGLVTPAEA DMIADPRKRR       300
     AILADSGKYG RVAKRNQKRT ITAATEAALA QHRIAAGEGG PELIKRRDQL SEWLRSRPDK       360
     LGQLPLMPQF PPIQPPATW                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page