(data stored in ACNUC30630 zone)

EMBL: CP001977.PE581

CP001977.PE581       Location/Qualifiers
FT   CDS             615700..616338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3595"
FT                   /product="MazG family protein"
FT                   /note="identified by match to protein family HMM PF03819;
FT                   match to protein family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01099"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC59"
FT                   /protein_id="ADE01099.1"
FT                   /translation="MAAEYARPRAEFSELVEVMARLRDECPWDRSQTHRSLVTYLVEET
FT                   GEVIDAIEAGTDDDLVEELGDLLLQVVFHSRIGEQGGRFDINEVVGGIVAKLVARHPYV
FT                   FSDEEVPEDLDAAWEARKAAAKGRTSSLDGIAYSLSSVARSAKVISRARTRGVGVKLAD
FT                   EPITAAETGDQLVTLIARAQASGVDADQALRDRLRDLEDEIRKAECRTD"
     MAAEYARPRA EFSELVEVMA RLRDECPWDR SQTHRSLVTY LVEETGEVID AIEAGTDDDL        60
     VEELGDLLLQ VVFHSRIGEQ GGRFDINEVV GGIVAKLVAR HPYVFSDEEV PEDLDAAWEA       120
     RKAAAKGRTS SLDGIAYSLS SVARSAKVIS RARTRGVGVK LADEPITAAE TGDQLVTLIA       180
     RAQASGVDAD QALRDRLRDL EDEIRKAECR TD                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page